DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and Chac2

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_080803.1 Gene:Chac2 MGIID:1915294 Length:178 Species:Mus musculus

Alignment Length:177 Identity:84/178 (47%)
Similarity:115/178 (65%) Gaps:6/178 (3%)


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRVYGV 138
            :|:||||||:||.||||.|:..|::..:.|||:|.|.||||:|.:|||||||:. ||. ..|:||
Mouse     1 MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVE-DPG-GSVWGV 63

  Fly   139 AYRIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTDG-AEPIQVIMYVATQANDSYAGDVWQVP 202
            ||::...::..|..:||:|||.||...::.|  ||.|. .:|..|::|:.|..|.:|.|.. .:.
Mouse    64 AYKLPVGKEEEVKTYLDFREKGGYRTTTVIF--YPKDSTTKPFSVLLYIGTCDNPNYLGPA-PLE 125

  Fly   203 CIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVK 249
            .||.|||::|||||.|.||||.||.::.:|.|...||||..|...||
Mouse   126 DIAEQIFNAAGPSGRNTEYLFELADSVRKLVPEDADEHLFSLEKLVK 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 84/178 (47%)
Chac2NP_080803.1 ChaC 1..174 CDD:282590 84/178 (47%)
Substrate binding. {ECO:0000250|UniProtKB:O75223} 3..8 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27371135
eggNOG 1 0.900 E1_COG3703
Hieranoid 1 1.000
Homologene 1 1.000 H48696
Inparanoid 1 1.050 159 1.000 Inparanoid score I4204
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001526
OrthoInspector 1 1.000 T1085272
orthoMCL 1 0.900 OOG5_127651
Panther 1 1.100 LDO PTHR12192
Phylome 1 0.910 0.654 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R197
TreeFam 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.