DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and chac1

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001103596.2 Gene:chac1 ZFINID:ZDB-GENE-030131-1957 Length:196 Species:Danio rerio

Alignment Length:182 Identity:73/183 (40%)
Similarity:97/183 (53%) Gaps:6/183 (3%)


  Fly    69 ATDADVWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQD 133
            |..:.:|||||||||||.||.|...:.|::.|:||||:.....|||..|.|||||||:..|..  
Zfish     8 AGKSSLWIFGYGSLVWKPDFKYKRSKVGYIKGYKRRFWHGDNFHRGDDEMPGRVVTLIEEDDV-- 70

  Fly   134 RVYGVAYRIAASQKGAVLDHLDYRE--KNGYERCSLEFHEYPTDGAEPIQVIMYVATQANDSYAG 196
            ..:|||:.:..||....|.:|:.||  :.||...:::|....|: ..|:|.::|:||..|..|.|
Zfish    71 CTWGVAFEVTGSQMEESLKYLNVREAVRGGYLTRAVDFFPRGTN-QPPVQALVYIATPDNPIYLG 134

  Fly   197 DVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACV 248
            .. ....||.||....|.||.|.|||..||..|....|...|.||..:.|.:
Zfish   135 PA-STEEIASQIAVCKGNSGHNIEYLLRLAEFMRVSCPDVDDPHLFSIEAAL 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 72/178 (40%)
chac1NP_001103596.2 ChaC 5..190 CDD:226226 73/183 (40%)
ChaC 13..183 CDD:282590 71/174 (41%)
Substrate binding. {ECO:0000250|UniProtKB:O75223} 15..20 5/5 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1238273at2759
OrthoFinder 1 1.000 FOG0001526
OrthoInspector 1 1.000 T597919
orthoMCL 1 0.900 OOG5_127651
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R197
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.