DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and chac2

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001025128.1 Gene:chac2 ZFINID:ZDB-GENE-050706-146 Length:182 Species:Danio rerio

Alignment Length:179 Identity:89/180 (49%)
Similarity:121/180 (67%) Gaps:7/180 (4%)


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRVYGV 138
            :|:||||||:||.||||.|:|.|||.||.|||:|.|.||||:|.:|||||||:. || :..|:||
Zfish     1 MWVFGYGSLIWKVDFPYEDKRVGFVKGFSRRFWQGSTDHRGVPGKPGRVVTLIE-DP-EGCVWGV 63

  Fly   139 AYRIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTD-GAEPIQ-VIMYVATQANDSYAGDVWQV 201
            ||::.:.|:..|.::||||||.||...::.||  |.| ..:|:| .::|:.:..|.:|.|.. .:
Zfish    64 AYKLPSGQEQEVKEYLDYREKGGYGVITVTFH--PKDEQQQPMQDTLLYIGSCDNPNYLGPA-PL 125

  Fly   202 PCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVKR 250
            ..||:||..|.||||.|.:|||.||.|:.||.|..:|:||..|...||:
Zfish   126 ETIAQQIVKSVGPSGKNTDYLFELADALRQLVPEDLDDHLFSLERLVKQ 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 89/180 (49%)
chac2NP_001025128.1 ChaC 1..175 CDD:282590 89/180 (49%)
ChaC 2..178 CDD:226226 89/179 (50%)
Substrate binding. {ECO:0000250|UniProtKB:O75223} 3..8 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27371335
eggNOG 1 0.900 E1_COG3703
Hieranoid 1 1.000
Homologene 1 1.000 H48696
Inparanoid 1 1.050 165 1.000 Inparanoid score I4110
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1238273at2759
OrthoFinder 1 1.000 FOG0001526
OrthoInspector 1 1.000 T597919
orthoMCL 1 0.900 OOG5_127651
Panther 1 1.100 LDO PTHR12192
Phylome 1 0.910 0.654 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R197
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.