DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and CHAC2

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001008708.1 Gene:CHAC2 HGNCID:32363 Length:184 Species:Homo sapiens

Alignment Length:177 Identity:86/178 (48%)
Similarity:114/178 (64%) Gaps:6/178 (3%)


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRVYGV 138
            :|:||||||:||.||||.|:..|::..:.|||:|.|.||||:|.:|||||||:. ||| ..|:||
Human     1 MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVE-DPA-GCVWGV 63

  Fly   139 AYRIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTD-GAEPIQVIMYVATQANDSYAGDVWQVP 202
            |||:...::..|..:||:|||.||...::.|  ||.| ..:|..|::|:.|..|..|.|.. .:.
Human    64 AYRLPVGKEEEVKAYLDFREKGGYRTTTVIF--YPKDPTTKPFSVLLYIGTCDNPDYLGPA-PLE 125

  Fly   203 CIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVK 249
            .||.|||::|||||.|.||||.||.::..|.|...||||..|...||
Human   126 DIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVK 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 86/178 (48%)
CHAC2NP_001008708.1 ChaC 1..174 CDD:282590 86/178 (48%)
Substrate binding. {ECO:0000250|UniProtKB:O75223} 3..8 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C27371341
eggNOG 1 0.900 E1_COG3703
Hieranoid 1 1.000
Homologene 1 1.000 H48696
Inparanoid 1 1.050 160 1.000 Inparanoid score I4187
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1238273at2759
OrthoFinder 1 1.000 FOG0001526
OrthoInspector 1 1.000 T1075165
orthoMCL 1 0.900 OOG5_127651
Panther 1 1.100 LDO PTHR12192
Phylome 1 0.910 0.692 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R197
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.