DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and Chac1

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001166908.1 Gene:Chac1 RGDID:1307153 Length:222 Species:Rattus norvegicus

Alignment Length:207 Identity:87/208 (42%)
Similarity:109/208 (52%) Gaps:22/208 (11%)


  Fly    59 ENSNQLEPPAA-----------TDAD---VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHS 109
            |::.|..||.:           .|.|   :|||||||||||.||.|.|.|.|||.|:.|||:|..
  Rat     4 ESAAQSTPPPSLSPAPSAQPSWEDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGYSRRFWQGD 68

  Fly   110 IDHRGIPERPGRVVTLLPGDPAQDRVYGVAYRIAASQKGAVLDHLDYREK--NGYERCSLEFHEY 172
            ..|||..:.||||||||  :..:...:||||::...|....|.:|:.||.  .||:...:.|  |
  Rat    69 TFHRGSDKMPGRVVTLL--EDHEGCTWGVAYQVRGEQVSEALKYLNVREAVLGGYDTKEVTF--Y 129

  Fly   173 PTDGA-EPIQVIMYVATQANDSYAGDVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGA 236
            |.|.. :|:..:.||||..|..|.|...: ..||.||.:..|.||.|.|||..||..|....|.|
  Rat   130 PQDTPDQPLTALAYVATPQNPGYLGPAPE-EVIATQILACRGFSGHNLEYLLRLADFMQLCGPQA 193

  Fly   237 VDEHLEELVACV 248
            .|||||.:|..|
  Rat   194 QDEHLEAIVDAV 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 81/179 (45%)
Chac1NP_001166908.1 ChaC 28..204 CDD:226226 81/181 (45%)
ChaC 33..206 CDD:282590 81/179 (45%)
Substrate binding. {ECO:0000250|UniProtKB:O75223} 35..40 5/5 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1238273at2759
OrthoFinder 1 1.000 FOG0001526
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127651
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.