DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and SPBC31F10.03

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_596565.1 Gene:SPBC31F10.03 / 2540372 PomBaseID:SPBC31F10.03 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:65/194 - (33%)
Similarity:100/194 - (51%) Gaps:17/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DADVWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGD------ 129
            :..:|:||||||:|.....|......|:.|:.|||:..|.||||....||.|:||:|.:      
pombe     7 EGSLWVFGYGSLIWHPPPHYDYSIPCFIKGYVRRFWMRSEDHRGTVNSPGLVLTLIPYEEWKQFS 71

  Fly   130 -----PAQDRVYGVAYRIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTDGAEPIQ-VIMYVAT 188
                 |..:..:|:|:||.|.....|.::||.||.|||...|:..:.:..|....:: .::||.|
pombe    72 DWSFTPFDEGCWGMAFRIPAKYATQVREYLDDREVNGYTAHSVPVYAHTGDEIPVLENCLVYVGT 136

  Fly   189 QANDSY--AGDVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVKR 250
            ..:..:  :.|:.|   :|:.|.:..|.||.|..|||.||..:..|.|.:.|.|:.||.|.|::
pombe   137 SKSPQFQPSDDLTQ---MAKIISTRRGKSGDNFVYLFELAKCLRHLSPESKDIHVFELEAEVRK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 65/191 (34%)
SPBC31F10.03NP_596565.1 ChaC 1..203 CDD:226226 65/194 (34%)
ChaC 10..198 CDD:282590 65/191 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I1782
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48696
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm47298
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - LDO PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
TreeFam 1 0.960 - -
1211.800

Return to query results.
Submit another query.