DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and SPBC31F10.03

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_596565.1 Gene:SPBC31F10.03 PomBaseID:SPBC31F10.03 Length:203 Species:Schizosaccharomyces pombe

Alignment Length:194 Identity:65/195 (33%)
Similarity:100/195 (51%) Gaps:17/195 (9%)


  Fly    71 DADVWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGD------ 129
            :..:|:||||||:|.....|......|:.|:.|||:..|.||||....||.|:||:|.:      
pombe     7 EGSLWVFGYGSLIWHPPPHYDYSIPCFIKGYVRRFWMRSEDHRGTVNSPGLVLTLIPYEEWKQFS 71

  Fly   130 -----PAQDRVYGVAYRIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTDGAEPIQ-VIMYVAT 188
                 |..:..:|:|:||.|.....|.::||.||.|||...|:..:.:..|....:: .::||.|
pombe    72 DWSFTPFDEGCWGMAFRIPAKYATQVREYLDDREVNGYTAHSVPVYAHTGDEIPVLENCLVYVGT 136

  Fly   189 QANDSY--AGDVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVKR 250
            ..:..:  :.|:.|   :|:.|.:..|.||.|..|||.||..:..|.|.:.|.|:.||.|.|::
pombe   137 SKSPQFQPSDDLTQ---MAKIISTRRGKSGDNFVYLFELAKCLRHLSPESKDIHVFELEAEVRK 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 65/192 (34%)
SPBC31F10.03NP_596565.1 ChaC 1..203 CDD:226226 65/195 (33%)
ChaC 10..198 CDD:282590 65/192 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H48696
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001526
OrthoInspector 1 1.000 T631673
orthoMCL 1 0.900 OOG5_127651
Panther 1 1.100 O PTHR12192
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R197
TreeFam 1 0.960
98.900

Return to query results.
Submit another query.