DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and F22F7.7

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_503578.1 Gene:F22F7.7 WormBaseID:WBGene00017724 Length:232 Species:Caenorhabditis elegans

Alignment Length:187 Identity:65/188 (35%)
Similarity:98/188 (52%) Gaps:19/188 (10%)


  Fly    68 AATDADVWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQ 132
            ::|...:||||||||:|...|.:...|:.:..|:.||.||.:..|||..:.||||.||:  :...
 Worm    44 SSTSQSLWIFGYGSLIWNPGFTFSTSRKAYAIGWARRMYQGNTYHRGDEKLPGRVATLI--EETN 106

  Fly   133 DRVYGVAYRI-AASQKGAVLDHLDYRE-KNGYE------RCSLEFHEYPTDGAEPIQVIMYVATQ 189
            ....||.:|: ..|.....:.:|:.|| .|||.      :.....|..||    .:..:..||.|
 Worm   107 SYTNGVVFRVDGKSAIATAVKYLEQRECDNGYAFRMVPVQIRSAAHRRPT----VVMALTCVADQ 167

  Fly   190 ANDSYAG--DVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEEL 244
            .|:.|.|  |:.:   :||:|.::.|.:|||.||:.|||..:.:|||...|:||.:|
 Worm   168 QNELYLGPDDLIK---MAREIVTAKGCAGPNCEYVLNLAENLRKLFPNDEDDHLFQL 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 64/182 (35%)
F22F7.7NP_503578.1 ChaC 50..230 CDD:226226 64/182 (35%)
ChaC 50..228 CDD:282590 64/182 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1238273at2759
OrthoFinder 1 1.000 FOG0001526
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127651
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R197
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.