DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2540 and chac1

Sequence 1:NP_572818.1 Gene:CG2540 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_002939592.1 Gene:chac1 XenbaseID:XB-GENE-6039063 Length:212 Species:Xenopus tropicalis

Alignment Length:198 Identity:79/199 (40%)
Similarity:109/199 (55%) Gaps:15/199 (8%)


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRVYGV 138
            :|||||||||||.:|.:...:.|||.|:.|:|:|....|||.|:.|||||||  .:...:..:|:
 Frog    18 LWIFGYGSLVWKPNFEFTSSKVGFVPGYSRKFWQGDTFHRGSPQMPGRVVTL--QEDYSECTWGI 80

  Fly   139 AYRIAASQKGAVLDHLDYREK--NGYERCSLEFHEYPTDGAE--PIQVIMYVATQANDSYAGDVW 199
            ||.:...|....|:|||.||.  .||....::|  ||.|..|  .:..::|:||..|..|.|...
 Frog    81 AYEVRGKQIELSLEHLDVRESVLGGYITKLVKF--YPQDEGEEGAVLALVYIATPQNPRYLGPAS 143

  Fly   200 QVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHL----EELVACVK--RYIVEDEPQ 258
            :.. ||.||.:.:|.:|.|.|||..||..|....|.|.|:||    |.||||:.  :..:.|:..
 Frog   144 EEE-IAAQIVACSGCAGHNIEYLLRLAEFMHNCCPNAEDKHLFSIEEALVACLSSAKMQILDKRV 207

  Fly   259 LIR 261
            |:|
 Frog   208 LLR 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 76/187 (41%)
chac1XP_002939592.1 ChaC 7..193 CDD:226226 74/180 (41%)
ChaC 18..193 CDD:282590 74/180 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1238273at2759
OrthoFinder 1 1.000 FOG0001526
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.