DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aven and Aven

Sequence 1:NP_001285162.1 Gene:Aven FlyBaseID:FBgn0030410 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_083120.2 Gene:Aven MGIID:1921518 Length:342 Species:Mus musculus

Alignment Length:293 Identity:64/294 (22%)
Similarity:104/294 (35%) Gaps:70/294 (24%)


  Fly    58 RRGNWQSSG-AGRSSLAPQRNRDMLDTLPSDTD------------------DVEQLGLDGAPIDE 103
            |.|.|:..| .|.:|...:.:.|. :|...:.|                  |.|: .::|    |
Mouse    61 RGGRWEPGGRGGGASTRVEEDSDS-ETYGEENDEQGNFSRRKIVSNWDRYQDTEK-EVNG----E 119

  Fly   104 NARAQLRAGDFQQLAQFPSLGGGHFTFGSEREWANVAEGQTKLHTKAASAYFTLN---------- 158
            :..:| |..||..|..........|.|..|:||    :|:|....:.::.|....          
Mouse   120 SGESQ-RGTDFSVLLSSAGDSFSQFRFAEEKEW----DGETSCPKQNSALYVDSESLVRALEQLP 179

  Fly   159 -LTRLNVGLQ----TIPLY------KRMD--YPASLFTRAQIAAQEKAAERAEAVYQQCILKDAN 210
             ..||||..:    ||||.      :|.|  ....:..|..|:....||........:..|:.:.
Mouse   180 LAVRLNVASELIQTTIPLELPQVKPRRNDDGKELGMHLRGPISELRSAAGACPRSLGRGSLRQSP 244

  Fly   211 GGAKSRAPS--------AKSNKDV-----APAAAE---KPIAASAAEPDELDELLAMTDTQLDIG 259
            .....:||:        .:...|:     ||...|   .|...|..:..|.|..:|..:|..:..
Mouse   245 LEGLQKAPTPTQSVADHLEEELDMLLHLDAPVQEEGNISPDQTSRDQEPEKDGQVAQEETGPEKP 309

  Fly   260 SGTITMPMPMVQPATPSSAASKNGVEEWLDSVL 292
            |.|....:...||:| |...::..:|:||||::
Mouse   310 SVTREKNVEPEQPST-SKNVTEEELEDWLDSMI 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AvenNP_001285162.1 PRK12278 <180..>248 CDD:237034 15/84 (18%)
AvenNP_083120.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BBSX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16524
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.