DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aven and aven

Sequence 1:NP_001285162.1 Gene:Aven FlyBaseID:FBgn0030410 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_005160816.1 Gene:aven ZFINID:ZDB-GENE-041001-171 Length:323 Species:Danio rerio

Alignment Length:307 Identity:59/308 (19%)
Similarity:99/308 (32%) Gaps:100/308 (32%)


  Fly    58 RRGNWQSSGAGRSSLAPQRNRDMLDTLPSDTDDVEQLGLDGA-------------------PIDE 103
            |||..:..|........:||:|.    |.|.::||.:..|..                   .::|
Zfish    44 RRGRGREHGPPADFRDFRRNQDE----PDDKENVEDMEEDNTFNRRKLESNWDRYKESEKEEMNE 104

  Fly   104 NARAQLRAGDFQQLAQFPSLGGGHFTFGSEREWANVAEGQTKLHTKAASAYFTLNLTRLNVGLQT 168
            :..|| |..|:..|..........|.|..|::|      :..|..|.......::|..|:..||.
Zfish   105 DVPAQ-RGTDYHVLLTSAGDSFTQFRFSDEKDW------ELDLLAKNQIPALFIDLPALSESLQE 162

  Fly   169 IPLYKRMDYPASLFTRAQIAAQEK---------AAERAEAVYQQCILKDANGGAKSRAPSAKSNK 224
            :||:.|::..|.|.       ||.         .:.|.          |..|.|..:||.|....
Zfish   163 LPLHTRLNLEAELI-------QESTPVDLPPMTVSHRT----------DLTGTAGLKAPPAGRES 210

  Fly   225 DVAPAAAEKPIAASAA----------EPDELDELLAMT----------------DTQLDIGSGTI 263
            .:....:.|||:.|..          :.||.|:.|.:.                .|..|:.:.|:
Zfish   211 SLGVPCSVKPISGSTVSVSISTTIPPDDDEDDQELHLLLNLQKPVTELPSVQSHTTANDVLNNTV 275

  Fly   264 TMPMP------------------MVQPATPSSAASKNGVEEWLDSVL 292
            ...:.                  .::|.......::..:|:||||::
Zfish   276 QAALSEEEVKKAAGDMKDMKSEVEIEPKPQKQEVTEEDLEDWLDSMI 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AvenNP_001285162.1 PRK12278 <180..>248 CDD:237034 17/87 (20%)
avenXP_005160816.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BBSX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16524
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.