DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aven and AVEN

Sequence 1:NP_001285162.1 Gene:Aven FlyBaseID:FBgn0030410 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_065104.1 Gene:AVEN HGNCID:13509 Length:362 Species:Homo sapiens

Alignment Length:342 Identity:73/343 (21%)
Similarity:106/343 (31%) Gaps:120/343 (35%)


  Fly    28 RSTTSSGSPPPTSRRSMVDVADSSDEPRLARRGNWQSSGAGRSSLAPQRNRDMLDTLPSDTD--- 89
            |.....|..|..|||          ||     |.|   |||.|  ||..:....:|...:.|   
Human    63 RGGRGGGGAPRGSRR----------EP-----GGW---GAGAS--APVEDDSDAETYGEENDEQG 107

  Fly    90 ---------------DVEQLGLDGAPIDENARAQLRAGDFQQLAQFPSLGGGHFTFGSEREWANV 139
                           |:|:      .::..:....|..||..|..........|.|..|:||.:.
Human   108 NYSKRKIVSNWDRYQDIEK------EVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSE 166

  Fly   140 AEGQTKLHTKAASAYFTLNLTRLNVGLQTIPLYKRMDYPASLFT-RAQIAAQEKAAERAEAVYQQ 203
            |.     ..|..||:: ::...|...||.:||..|::..|.|.. ...:...:...:|.:     
Human   167 AS-----CPKQNSAFY-VDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTD----- 220

  Fly   204 CILKDANG---------GAKSRAP--------------SAKSNKDVAPAA-AEKPIAASAAEPDE 244
                |..|         |...|.|              ..|.|....|:. ::||.:...:..|.
Human   221 ----DGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDH 281

  Fly   245 LDE---LLAMTDTQLDIGSGTI---------------------TMPMPMV------QPATPSSAA 279
            |:|   ||...|..:..|...:                     ....|.|      :|..||:  
Human   282 LEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPST-- 344

  Fly   280 SKNGVEE----WLDSVL 292
            |||..||    ||||::
Human   345 SKNVTEEELEDWLDSMI 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AvenNP_001285162.1 PRK12278 <180..>248 CDD:237034 15/96 (16%)
AVENNP_065104.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BBSX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16524
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.