| Sequence 1: | NP_001285162.1 | Gene: | Aven / 32215 | FlyBaseID: | FBgn0030410 | Length: | 294 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_065104.1 | Gene: | AVEN / 57099 | HGNCID: | 13509 | Length: | 362 | Species: | Homo sapiens |
| Alignment Length: | 342 | Identity: | 73/342 - (21%) |
|---|---|---|---|
| Similarity: | 106/342 - (30%) | Gaps: | 120/342 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 RSTTSSGSPPPTSRRSMVDVADSSDEPRLARRGNWQSSGAGRSSLAPQRNRDMLDTLPSDTD--- 89
Fly 90 ---------------DVEQLGLDGAPIDENARAQLRAGDFQQLAQFPSLGGGHFTFGSEREWANV 139
Fly 140 AEGQTKLHTKAASAYFTLNLTRLNVGLQTIPLYKRMDYPASLFT-RAQIAAQEKAAERAEAVYQQ 203
Fly 204 CILKDANG---------GAKSRAP--------------SAKSNKDVAPAA-AEKPIAASAAEPDE 244
Fly 245 LDE---LLAMTDTQLDIGSGTI---------------------TMPMPMV------QPATPSSAA 279
Fly 280 SKNGVEE----WLDSVL 292 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Aven | NP_001285162.1 | PRK12278 | <180..>248 | CDD:237034 | 15/95 (16%) |
| AVEN | NP_065104.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..111 | 18/67 (27%) | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 214..237 | 4/31 (13%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 253..362 | 26/111 (23%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2BBSX | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR16524 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.000 | |||||