DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aven and Aven

Sequence 1:NP_001285162.1 Gene:Aven FlyBaseID:FBgn0030410 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_006234769.1 Gene:Aven RGDID:1309928 Length:342 Species:Rattus norvegicus

Alignment Length:311 Identity:67/312 (21%)
Similarity:105/312 (34%) Gaps:89/312 (29%)


  Fly    58 RRGNWQSSGAGRSSLAPQRNR-------DMLDTLPSDTDDVEQLGLDGAPIDENARAQL------ 109
            |||..:....||...||:..|       ....|...:..|.|..|.:.......:|.::      
  Rat    44 RRGRGRGFRRGRGGGAPRGGRREPGGRGGGASTRVEEDSDSETYGEENDEQGHFSRRKIVSNWDR 108

  Fly   110 ----------------RAGDFQQLAQFPSLGGGHFTFGSEREWANVAEGQTKLHTKAASAYF-TL 157
                            |..||..|..........|.|..|:||    :|:|....:.::.|. :.
  Rat   109 YQDTEKEVNGESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEW----DGETSCSKQNSALYVDSE 169

  Fly   158 NLTRLNVGLQTIPLYKRMDYPASLFTRAQIAAQEKAAERAEAVYQQ---------CILKDANGG- 212
            :|.|   .||.:||..|::..:.|...|......:|..|.....::         ..|:.|.|| 
  Rat   170 SLVR---ALQQLPLAVRLNVASELIQTAVPLELPQAKPRRNDDGKELGMQLRGPLSQLRSAAGGC 231

  Fly   213 -------AKSRAPSAKSNKDVAPAAAEKPIAASAAEPDELDELLAM------------TDTQLD- 257
                   :..::||..|.|     |:..|.:|:....:|||.||.:            ..|..| 
  Rat   232 PRSLGRDSLRQSPSEGSQK-----ASSPPQSAADHLEEELDMLLHLDAPVKEEDSLSPDQTSQDQ 291

  Fly   258 -------IGSGTITMPMPMV---------QPATPSSAASKNGVEEWLDSVL 292
                   |....|....|.|         ||:| |...::..:|:||||::
  Rat   292 EPERDGQIAQEEIAPEKPSVTRDKTVEPGQPST-SKTVTEEELEDWLDSMI 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AvenNP_001285162.1 PRK12278 <180..>248 CDD:237034 18/85 (21%)
AvenXP_006234769.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BBSX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16524
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.