DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aven and aven

Sequence 1:NP_001285162.1 Gene:Aven FlyBaseID:FBgn0030410 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_002935375.1 Gene:aven XenbaseID:XB-GENE-6456683 Length:298 Species:Xenopus tropicalis

Alignment Length:319 Identity:71/320 (22%)
Similarity:107/320 (33%) Gaps:120/320 (38%)


  Fly    58 RRGNWQSSGAGRSSLAP------------QRN-------RDMLDTL-PSDTDDVEQLGLDGAPID 102
            ||..|...|.|...:.|            |||       .|..:.: |.:.|:...||.....|.
 Frog    15 RRRPWGERGRGGDRVGPAHSGRGYRGADRQRNEPSEPRIEDRNEAVEPQEEDEQVSLGFSRRKIS 79

  Fly   103 EN--------------ARAQLRAGDFQQLAQFPSLGGGHFT---FGSEREWANVAEGQTKLHTKA 150
            .|              ::...|..|:..|.   |..|..||   |..|::|    |.:|..:.:|
 Frog    80 SNWDRYEETEKESESESKVLQRGADYSVLL---SSAGDSFTQFRFADEKDW----EAETPSYKQA 137

  Fly   151 ASAYF-TLNLTRLNVGLQTIPLYKRMDYPASLFTRAQIAAQEKAAERAEAVYQQCIL-------- 206
            ::... ..:|.|:   ||.:||:.|::....|       .||...:.......:.||        
 Frog   138 SAVCLDPQSLVRV---LQELPLHLRLNVEPEL-------VQEVLPQELPHFKTRDILITPPVIQA 192

  Fly   207 KDANGGAKS----RAPSAK--SN----KDVAP-----------AAAEKPIAASAA-----EPDEL 245
            ..:.|.|.|    .||..:  ||    :|.:|           .:.|.|:..:|.     |..|.
 Frog   193 PPSTGAASSTQVGMAPPEEQVSNTTRAQDSSPQLELDEELDFLLSLEAPVKEAAGVKPTNEEKEC 257

  Fly   246 D------ELLAMTDTQLDIGSGTITMPMPMVQPATPSSAASKN------GVEEWLDSVL 292
            |      |||.:||..                   .||:|.||      .:|:||||::
 Frog   258 DLHGKRQELLPITDED-------------------ASSSAEKNKSVTEEDLEDWLDSMI 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AvenNP_001285162.1 PRK12278 <180..>248 CDD:237034 21/108 (19%)
avenXP_002935375.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BBSX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.