DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and LBX2

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001269359.1 Gene:LBX2 HGNCID:15525 Length:198 Species:Homo sapiens

Alignment Length:150 Identity:50/150 (33%)
Similarity:67/150 (45%) Gaps:30/150 (20%)


  Fly   115 GLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKF 179
            ||.|.|...:.| |......|||                 ..|||.|:.|||||..|:..|||:|
Human    58 GLDARALQPSEG-RAGPDALGPG-----------------PFGRKRRKSRTAFTAQQVLELERRF 104

  Fly   180 RCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEK--------DF 236
            ..||||:.::|..:|..|.|:..||.||:||||.|.||.    :|::|......:        ..
Human   105 VFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRD----VEEMRADVASLRALSPEVLCSL 165

  Fly   237 VVQDGGGAGGLGCCPSGLSS 256
            .:.:|....||...|:|..|
Human   166 ALPEGAPDPGLCLGPAGPDS 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 27/53 (51%)
LBX2NP_001269359.1 Homeobox 88..141 CDD:278475 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.