DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HB4

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_182018.1 Gene:HB4 / 819100 AraportID:AT2G44910 Length:318 Species:Arabidopsis thaliana


Alignment Length:258 Identity:65/258 - (25%)
Similarity:97/258 - (37%) Gaps:57/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SH----HHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVA------------SGLSA 105
            ||    |:..:||..:||.....:|.|...:|:...|.........||            |..||
plant    50 SHPQKIHNISWTHLFQSSGIKRTTAERNSDAGSFLRGFNVNRAQSSVAVVDLEEEAAVVSSPNSA 114

  Fly   106 AAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGG-----GTSGGYAEHKLQLSKSGRKPRRRRT 165
            .::.:|....|..|.....|....|:...|.||||     |.:|..:..||:|||.         
plant   115 VSSLSGNKRDLAVARGGDENEAERASCSRGGGSGGSDDEDGGNGDGSRKKLRLSKD--------- 170

  Fly   166 AFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK-RQNQLRLEQLRH- 228
                 |...||..|:....|:...:..:|:.|||...||:.|:||||.:.| :|.::..|.|:. 
plant   171 -----QALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRC 230

  Fly   229 --QATMEKDFVVQDGGGAGG----------------LGCCPS--GLSSSFSAAAAAAAAASNP 271
              ..|.|...:.::......                |..|||  .:|||.:...||.:..:.|
plant   231 CDNLTEENRRLQKEVSELRALKLSPHLYMHMTPPTTLTMCPSCERVSSSAATVTAAPSTTTTP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 16/52 (31%)
HB4NP_182018.1 HD-ZIP_N 8..124 CDD:398351 17/73 (23%)
Homeobox 166..216 CDD:395001 19/63 (30%)
HALZ 218..261 CDD:128634 5/42 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.