DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HB6

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:124 Identity:30/124 - (24%)
Similarity:53/124 - (42%) Gaps:25/124 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GYAEHKLQLSKS----GRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVK 205
            ||.|.:..:.:.    |...::||.:..  |:..||:.|..:..|....:..:|:.|.|...||.
plant    42 GYEEEEEAIVEERGHVGLSEKKRRLSIN--QVKALEKNFELENKLEPERKVKLAQELGLQPRQVA 104

  Fly   206 TWYQNRRTKWKRQN--------QLRLEQLRH---QATMEKDFVVQD--------GGGAG 245
            .|:||||.:||.:.        :.:.:.|||   ....:.:.::|:        .||.|
plant   105 VWFQNRRARWKTKQLEKDYGVLKTQYDSLRHNFDSLRRDNESLLQEISKLKTKLNGGGG 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 18/55 (33%)
HB6NP_565536.1 Homeodomain 62..115 CDD:459649 17/54 (31%)
HALZ 117..158 CDD:460477 4/40 (10%)

Return to query results.
Submit another query.