DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and lbx1b

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001156784.1 Gene:lbx1b ZFINID:ZDB-GENE-050309-27 Length:265 Species:Danio rerio

Alignment Length:174 Identity:56/175 (32%)
Similarity:73/175 (42%) Gaps:49/175 (28%)


  Fly   105 AAAAAAGVAAGLLAAAASGAN-----GDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRR 164
            |:....|:..|:| .||.|.:     |.||                          |.:|.|:.|
Zfish    88 ASKTFKGLELGVL-QAAEGKDGLKLFGQRD--------------------------SPKKRRKSR 125

  Fly   165 TAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQ 229
            ||||:.||..||::|..|||||.|||..:|..|.|:..||.||:||||.|.||.    ||:::  
Zfish   126 TAFTNHQLYELEKRFLHQKYLSPADRDQIAHQLGLTNAQVITWFQNRRAKLKRD----LEEMK-- 184

  Fly   230 ATMEKDFVVQDGGGAGGLGCCPSGLSSSFS--AAAAAAAAASNP 271
                     .|.......|..|....:..:  ...|||.|..||
Zfish   185 ---------ADVESVRSTGLVPLDKLAKLADLERCAAAGATGNP 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 30/53 (57%)
lbx1bNP_001156784.1 Homeobox 124..177 CDD:278475 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.