DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and Barx2

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_003750505.1 Gene:Barx2 RGDID:1584840 Length:290 Species:Rattus norvegicus

Alignment Length:113 Identity:53/114 (46%)
Similarity:65/114 (57%) Gaps:14/114 (12%)


  Fly   105 AAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTH 169
            ||.|||..||...||||....|:..|:..|              ...|.:...:||||.||.||.
  Rat   103 AAEAAAAAAAAAAAAAAETPGGEALASSES--------------ETEQPTPRQKKPRRSRTIFTE 153

  Fly   170 AQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217
            .||..||:||:.|||||..||.|:|::|.|::.||||||||||.|||:
  Rat   154 LQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKK 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 33/53 (62%)
Barx2XP_003750505.1 Homeobox 147..200 CDD:278475 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.