DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and Nkx1-1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_035450.1 Gene:Nkx1-1 MGIID:109346 Length:440 Species:Mus musculus

Alignment Length:247 Identity:90/248 (36%)
Similarity:109/248 (44%) Gaps:53/248 (21%)


  Fly    84 GTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGG-----SGPGSGGGTS 143
            ||....||.||.|   |.|.....||...|:.:...||.|..|:.....|     :|.||.|.|.
Mouse   204 GTEEPRGGSGGLG---ARGSGCPGAAEVEASPVDDTAAPGPRGNSPGAPGPPATATGAGSAGSTP 265

  Fly   144 GGYA-------EHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSE 201
            .|.|       :.....|||| ||||.|||||:.||..||.||:..:||||.:|.::|.:|:|:|
Mouse   266 QGAAVTTKPKRKRTGSDSKSG-KPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTE 329

  Fly   202 TQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAG-------GLGCCPSGLSS-SF 258
            ||||.|:||||||||:||.            ..|.....|||.|       |.| .|.|||. |.
Mouse   330 TQVKIWFQNRRTKWKKQNP------------GADTSAPTGGGGGPGPGAGPGAG-LPGGLSPLSP 381

  Fly   259 SAAAAAAAAASNPCN----------------FLTSAAAAAIFRNVGYVHGCP 294
            |....|..|...|..                ||:|.|..:.|......:|.|
Mouse   382 SPPMGAPLALHGPAGYPAHSPGGLVCAAQLPFLSSPAVLSPFVLGSQTYGAP 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/53 (60%)
Nkx1-1NP_035450.1 Homeobox 292..344 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.