DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and vox

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_571773.1 Gene:vox ZFINID:ZDB-GENE-010108-1 Length:242 Species:Danio rerio

Alignment Length:143 Identity:46/144 (32%)
Similarity:64/144 (44%) Gaps:34/144 (24%)


  Fly    98 GVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRR 162
            |.:||..:.|||:.     .|:...|.:.::|          |.|                  ||
Zfish    88 GYSSGYESEAAASE-----CASVEDGHDAEKD----------GAT------------------RR 119

  Fly   163 RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQ-NQLRLEQL 226
            .||.||..|:..||:.|...|||...:|...|..|.|||||::||:||||.|.||: .::|.:.|
Zfish   120 IRTKFTPEQIDKLEKIFNKHKYLDAGERVKTALKLGLSETQIRTWFQNRRMKLKREVQEMRADFL 184

  Fly   227 RHQATMEKDFVVQ 239
            ..|..:.....||
Zfish   185 LPQMVLPPVIPVQ 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/53 (49%)
voxNP_571773.1 COG5576 75..>187 CDD:227863 43/132 (33%)
Homeobox 121..173 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.