DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and lbx2

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:195 Identity:58/195 - (29%)
Similarity:85/195 - (43%) Gaps:46/195 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GGGGVASGLSAAAA--------AAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKL 151
            |.....:|:||.::        |:....||..:....|.|....|               |..:.
Zfish    71 GSSASRNGISAPSSPLCALEELASKTFKGLEVSVIQAAEGREHIN---------------AFGQR 120

  Fly   152 QLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK 216
            |.||   |.|:.|||||:.|:..||::|..|||||.|||..:|:.|.|:..||.||:||||.|.|
Zfish   121 QASK---KRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLK 182

  Fly   217 RQ-----------NQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASN 270
            |.           .::..:.|:...:||.   ::|..|..|      .:|.|.|..|...:.:|:
Zfish   183 RDLEEMKADVESLKKIPPQALQKLVSMED---MEDAHGGSG------PISPSLSPRAFPQSPSSS 238

  Fly   271  270
            Zfish   239  238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 30/55 (55%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Homeodomain 127..183 CDD:459649 30/55 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.