DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and BARHL1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_064448.1 Gene:BARHL1 HGNCID:953 Length:327 Species:Homo sapiens

Alignment Length:232 Identity:85/233 (36%)
Similarity:105/233 (45%) Gaps:62/233 (27%)


  Fly    44 DSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGPG-----SGTGSGGGGGGGG-GGGVASG 102
            |.....|:..|.||       ...|||  |..|:...||     :||...||..|.| ...:..|
Human    26 DPLLGDCRSPLELS-------PRSESS--SDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPG 81

  Fly   103 -LSAAAAAAGVAAGL-----------LAAAASGANGDRDANGGSGPGSGGGTSGGYAE-HKLQLS 154
             |||.|.:..|.:..           |||.|..::..:.|    .|..||..:...|| .:.:|.
Human    82 QLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPA----APEPGGRLAAKAAEDFRDKLD 142

  Fly   155 KSG------------------------------RKPRRRRTAFTHAQLAYLERKFRCQKYLSVAD 189
            |||                              :|||:.|||||..|||.|||.|..||||||.|
Human   143 KSGSNASSDSEYKVKEEGDREISSSRDSPPVRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQD 207

  Fly   190 RSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQL 226
            |.::|.:|||::|||||||||||||||||..:.||.|
Human   208 RMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELL 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 38/53 (72%)
BARHL1NP_064448.1 Homeobox 182..234 CDD:306543 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.