Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064448.1 | Gene: | BARHL1 / 56751 | HGNCID: | 953 | Length: | 327 | Species: | Homo sapiens |
Alignment Length: | 232 | Identity: | 85/232 - (36%) |
---|---|---|---|
Similarity: | 105/232 - (45%) | Gaps: | 62/232 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 DSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGPG-----SGTGSGGGGGGGG-GGGVASG 102
Fly 103 -LSAAAAAAGVAAGL-----------LAAAASGANGDRDANGGSGPGSGGGTSGGYAE-HKLQLS 154
Fly 155 KSG------------------------------RKPRRRRTAFTHAQLAYLERKFRCQKYLSVAD 189
Fly 190 RSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQL 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 37/52 (71%) |
BARHL1 | NP_064448.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..90 | 23/72 (32%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 112..184 | 15/75 (20%) | |||
Homeobox | 182..235 | CDD:395001 | 38/52 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..327 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X1387 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.770 |