Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067545.3 | Gene: | BARX1 / 56033 | HGNCID: | 955 | Length: | 254 | Species: | Homo sapiens |
Alignment Length: | 238 | Identity: | 74/238 - (31%) |
---|---|---|---|
Similarity: | 89/238 - (37%) | Gaps: | 91/238 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 GCQQELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVA 113
Fly 114 AG---------LLAA----------------------AASGANGDRDANGGSGPGSGGGTSGGYA 147
Fly 148 EHKLQL------------SKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLS 200
Fly 201 ETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGG 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 33/52 (63%) |
BARX1 | NP_067545.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | 2/2 (100%) | |
Homeobox | 145..199 | CDD:395001 | 34/53 (64%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..254 | 3/3 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |