DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and barhl1a

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001017712.2 Gene:barhl1a ZFINID:ZDB-GENE-050417-212 Length:299 Species:Danio rerio

Alignment Length:262 Identity:79/263 (30%)
Similarity:109/263 (41%) Gaps:79/263 (30%)


  Fly     1 MQSSKSFLIRDLL-----GDLINRRQTDSELELSNDDSDID-------------IEDRSTPDSTA 47
            :.:..||.|..:|     ...:::.:..|..||| ..||:|             :||.....:.|
Zfish     3 VSNGSSFGIESILSHRASSPCMSKGECRSPAELS-PRSDLDSGCSSPPSPRRSSVEDAVQRRARA 66

  Fly    48 AGCQQELLLSHHHRRFTHH--------DESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLS 104
            .|....|.:|...|..|..        |...:.:|     .|.|.||.                 
Zfish    67 LGLDSPLQISQQPRTVTSSFLIRDILADCKPLAAC-----APYSSTGQ----------------- 109

  Fly   105 AAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGY-----AEHKLQLSKSG-----RK 159
                :|..|...:....|.::.|.:                |     |:.::..|:..     :|
Zfish   110 ----SAQDAEDCMDKLHSNSSSDSE----------------YRVKDEADREISSSRDSPNSRLKK 154

  Fly   160 PRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLE 224
            ||:.|||||..|||.|||.|..||||||.||.::|.:|||::|||||||||||||||||..:.||
Zfish   155 PRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLE 219

  Fly   225 QL 226
            .|
Zfish   220 LL 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 38/53 (72%)
barhl1aNP_001017712.2 TPP_enzymes <122..177 CDD:294952 20/71 (28%)
Homeobox 159..211 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.