DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and barhl1a

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001017712.2 Gene:barhl1a / 550407 ZFINID:ZDB-GENE-050417-212 Length:299 Species:Danio rerio


Alignment Length:262 Identity:79/262 - (30%)
Similarity:109/262 - (41%) Gaps:79/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQSSKSFLIRDLL-----GDLINRRQTDSELELSNDDSDID-------------IEDRSTPDSTA 47
            :.:..||.|..:|     ...:::.:..|..||| ..||:|             :||.....:.|
Zfish     3 VSNGSSFGIESILSHRASSPCMSKGECRSPAELS-PRSDLDSGCSSPPSPRRSSVEDAVQRRARA 66

  Fly    48 AGCQQELLLSHHHRRFTHH--------DESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLS 104
            .|....|.:|...|..|..        |...:.:|     .|.|.||.                 
Zfish    67 LGLDSPLQISQQPRTVTSSFLIRDILADCKPLAAC-----APYSSTGQ----------------- 109

  Fly   105 AAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGY-----AEHKLQLSKSG-----RK 159
                :|..|...:....|.::.|.:                |     |:.::..|:..     :|
Zfish   110 ----SAQDAEDCMDKLHSNSSSDSE----------------YRVKDEADREISSSRDSPNSRLKK 154

  Fly   160 PRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLE 224
            ||:.|||||..|||.|||.|..||||||.||.::|.:|||::|||||||||||||||||..:.||
Zfish   155 PRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLE 219

  Fly   225 QL 226
            .|
Zfish   220 LL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 37/52 (71%)
barhl1aNP_001017712.2 TPP_enzymes <122..177 CDD:294952 20/70 (29%)
Homeobox 159..211 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.