DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and Lbx1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001040573.1 Gene:Lbx1 RGDID:1564197 Length:285 Species:Rattus norvegicus

Alignment Length:231 Identity:67/232 (29%)
Similarity:92/232 (40%) Gaps:78/232 (34%)


  Fly   113 AAGLLAAAASGANGDRDANGG-----------------------------------SGPGSGGGT 142
            ||.|||||      |:.|.||                                   :..|..|.|
  Rat    56 AAHLLAAA------DKHAPGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMT 114

  Fly   143 SGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
            ..|..:       :.:|.|:.|||||:.|:..||::|..|||||.|||..:|:.|.|:..||.||
  Rat   115 IFGQRQ-------TPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITW 172

  Fly   208 YQNRRTKWKRQNQLRLEQLRHQ------------------ATMEKDFVVQDGGGAGGLGCCPSGL 254
            :||||.|.||.    ||:::..                  |.:|::.....|||.||.|.|....
  Rat   173 FQNRRAKLKRD----LEEMKADVESAKKLGPSGQMDIVALAELEQNSEASGGGGGGGGGGCGRAK 233

  Fly   255 SSSFSAAAAAAAAAS--------NPCNFLTSAAAAA 282
            |...|.|....|..:        :|.:.||...|::
  Rat   234 SRPGSPALPPGAPQAPGGGPLQLSPASPLTDQRASS 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 29/53 (55%)
Lbx1NP_001040573.1 Homeobox 128..181 CDD:278475 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.