DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and Tlx1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_006231616.1 Gene:Tlx1 RGDID:1563655 Length:345 Species:Rattus norvegicus

Alignment Length:233 Identity:68/234 (29%)
Similarity:90/234 (38%) Gaps:86/234 (37%)


  Fly    76 SATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGG 140
            ||......|||:.|.||.||.||.|.| ...|.:.|..||       ..|.:....||.|||.||
  Rat    62 SAAGAGAGGTGAYGTGGPGGPGGPAGG-GGGACSMGPLAG-------SYNVNMALAGGPGPGGGG 118

  Fly   141 GTSG----------------------GYAEHKLQLS--------------------------KSG 157
            |.:|                      |...|...|:                          :|.
  Rat   119 GGAGAGGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAVPGVNNLTGLTFPWMESN 183

  Fly   158 R------------------------------KPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSD 192
            |                              |.::.||:||..|:..||::|..||||:.|:|:.
  Rat   184 RRYTKDRFTVALSPFTVTRRIGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAA 248

  Fly   193 VAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQA 230
            :|:.|.:::.|||||:|||||||:||.....|..|.||
  Rat   249 LAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQA 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 28/53 (53%)
Tlx1XP_006231616.1 Homeobox 219..272 CDD:278475 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.