| Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_573065.4 | Gene: | Tlx3 / 497881 | RGDID: | 1564190 | Length: | 291 | Species: | Rattus norvegicus |
| Alignment Length: | 204 | Identity: | 62/204 - (30%) |
|---|---|---|---|
| Similarity: | 87/204 - (42%) | Gaps: | 49/204 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 77 ATRGPGSGTGSGGGGGGGGGGGVAS------GLSAAAAAAGVAAGLLAAAASG---ANGDRDANG 132
Fly 133 GSGP---------------GSGGGTSGGYAEHKLQLSK----------------------SGRKP 160
Fly 161 RRR---RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
Fly 223 LEQLRHQAT 231 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 27/55 (49%) |
| Tlx3 | XP_573065.4 | Homeobox | 169..223 | CDD:395001 | 27/53 (51%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||