DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and Tlx3

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001064411.3 Gene:Tlx3 RGDID:1564190 Length:338 Species:Rattus norvegicus

Alignment Length:204 Identity:62/205 (30%)
Similarity:87/205 (42%) Gaps:49/205 (24%)


  Fly    77 ATRGPGSGTGSGGGGGGGGGGGVAS------GLSAAAAAAGVAAGLLAAAASG---ANGDRDANG 132
            |.|||...:..||..||..|....|      ||.|....||..:..|:.|.:|   ....|...|
  Rat    81 APRGPDGASYLGGPPGGRPGAAYPSLPASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPG 145

  Fly   133 GSGP---------------GSGGGTSGGYAEHKLQLSK----------------------SGRKP 160
            ...|               .|.||.:..:.|...:..|                      ..|.|
  Rat   146 AVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTP 210

  Fly   161 RRR---RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
            .:|   ||:|:..|:..||::|..||||:.|:|:.:|::|.:::.|||||:|||||||:||....
  Rat   211 PKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEE 275

  Fly   223 LEQLRHQAT 231
            .|..|.||:
  Rat   276 REAERQQAS 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 28/56 (50%)
Tlx3XP_001064411.3 Homeobox 216..269 CDD:278475 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.