DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and NPM1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001341935.1 Gene:NPM1 HGNCID:7910 Length:294 Species:Homo sapiens

Alignment Length:43 Identity:12/44 (27%)
Similarity:14/44 (32%) Gaps:13/44 (30%)


  Fly    23 DSELELSNDDSDIDIED-------------RSTPDSTAAGCQQ 52
            |.|.:...||.|.|.:|             |.||...|....|
Human   167 DDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQ 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475
NPM1NP_001341935.1 Required for interaction with SENP3 1..186 7/19 (37%)
Necessary for interaction with APEX1. {ECO:0000269|PubMed:19188445} 1..117
Nucleoplasmin 18..116 CDD:308605
Nuclear localization signal. {ECO:0000255} 152..157
Nuclear localization signal. {ECO:0000255} 191..197 0/6 (0%)
Required for nucleolar localization 243..294
NPM1-C 245..293 CDD:318505
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.