DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and slou

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001262808.1 Gene:slou FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster

Alignment Length:286 Identity:82/287 (29%)
Similarity:109/287 (38%) Gaps:88/287 (31%)


  Fly    19 RRQTDSELELSNDDSDIDIEDRSTP-----------DSTAAGCQQELLLSHHHRR--FTHHDESS 70
            |..|..||.:..:|.|.:....|||           :|:||........|....|  .|.....|
  Fly   384 RSDTSEELNVDGNDEDSNDGSHSTPSVCPVDLTRSVNSSAAANPSSASTSASSDRDAATKRLAFS 448

  Fly    71 VESCLSATRGPGSGTGSGGGGGG-------------------------------------GGGGG 98
            ||:.|...:..|:...||..|..                                     ..|..
  Fly   449 VENILDPNKFTGNKLPSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSD 513

  Fly    99 VASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRR 163
            :....|...:..|              |.|:.:|.||.|.|||:                ||||.
  Fly   514 IDDPSSETDSKKG--------------GSRNGDGKSGGGGGGGS----------------KPRRA 548

  Fly   164 RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRH 228
            |||||:.||..||.||:..:||||.:|.::|.:|:|:|||||.|:||||||||:||.        
  Fly   549 RTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNP-------- 605

  Fly   229 QATMEKDFVVQDGGGAGGLGCCPSGL 254
            ...:....:...|||:.|.|...|||
  Fly   606 GMDVNSPTIPPPGGGSFGPGAYASGL 631

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/53 (60%)
slouNP_001262808.1 Homeobox 549..601 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.