DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and slou

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster


Alignment Length:286 Identity:82/286 - (28%)
Similarity:109/286 - (38%) Gaps:88/286 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRQTDSELELSNDDSDIDIEDRSTP-----------DSTAAGCQQELLLSHHHRR--FTHHDESS 70
            |..|..||.:..:|.|.:....|||           :|:||........|....|  .|.....|
  Fly   384 RSDTSEELNVDGNDEDSNDGSHSTPSVCPVDLTRSVNSSAAANPSSASTSASSDRDAATKRLAFS 448

  Fly    71 VESCLSATRGPGSGTGSGGGGGG-------------------------------------GGGGG 98
            ||:.|...:..|:...||..|..                                     ..|..
  Fly   449 VENILDPNKFTGNKLPSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSD 513

  Fly    99 VASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRR 163
            :....|...:..|              |.|:.:|.||.|.|||:                ||||.
  Fly   514 IDDPSSETDSKKG--------------GSRNGDGKSGGGGGGGS----------------KPRRA 548

  Fly   164 RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRH 228
            |||||:.||..||.||:..:||||.:|.::|.:|:|:|||||.|:||||||||:||.        
  Fly   549 RTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNP-------- 605

  Fly   229 QATMEKDFVVQDGGGAGGLGCCPSGL 254
            ...:....:...|||:.|.|...|||
  Fly   606 GMDVNSPTIPPPGGGSFGPGAYASGL 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 31/52 (60%)
slouNP_001262808.1 Homeobox 549..601 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.