DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and lbe

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_524435.2 Gene:lbe FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster

Alignment Length:121 Identity:49/122 (40%)
Similarity:65/122 (53%) Gaps:21/122 (17%)


  Fly   158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
            :|.|:.|||||:.|:..||::|..|||||.|||.::|.:|.||..||.||:||||.|.||.    
  Fly   351 KKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRD---- 411

  Fly   223 LEQLRHQATMEKDF-----------VVQDGGGAGGLGCCPSGLSSSFSAAAAAAAA 267
            :|:|:      |||           .:::......|...|...|.....|||||||
  Fly   412 IEELK------KDFDSVKVFSAHKSFLENVNDLSILKKKPMHESDMVGLAAAAAAA 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 30/53 (57%)
lbeNP_524435.2 Homeobox 356..409 CDD:278475 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.