DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and ventx2.1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_988862.1 Gene:ventx2.1 XenbaseID:XB-GENE-919664 Length:333 Species:Xenopus tropicalis

Alignment Length:204 Identity:66/205 (32%)
Similarity:93/205 (45%) Gaps:42/205 (20%)


  Fly    22 TDSELEL-SNDDSDI----DIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGP 81
            :||||.| ||:|.|:    |:...|||....       ||   ||....|:.|.:.|..:.|  |
 Frog    83 SDSELSLYSNEDEDLFCEKDLNTPSTPGDNG-------LL---HRDTATHEYSGMVSVPANT--P 135

  Fly    82 GSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGY 146
            .: |.:......|......||..:.|:.:.      :.|..|     ||.....|..   ||   
 Frog   136 RT-TSNEDAAKSGYSTSTDSGYESEASRSS------STAPEG-----DATVSLSPND---TS--- 182

  Fly   147 AEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNR 211
                   .:.|:..||.|||||..|::.||:.|:..:||..::|..:|..|.|||.|:|||:|||
 Frog   183 -------DEEGKLGRRLRTAFTSDQISTLEKTFQKHRYLGASERRKLAAKLQLSEVQIKTWFQNR 240

  Fly   212 RTKWKRQNQ 220
            |.|:||:.|
 Frog   241 RMKYKREIQ 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/53 (49%)
ventx2.1NP_988862.1 Homeobox 193..245 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.