DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and Barx1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001102350.1 Gene:Barx1 RGDID:1310884 Length:254 Species:Rattus norvegicus

Alignment Length:243 Identity:79/244 (32%)
Similarity:94/244 (39%) Gaps:101/244 (41%)


  Fly    49 GCQQELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVA 113
            ||...  ..|.:|.|      .:|..|:...||                     ..||.|||..|
  Rat    17 GCADH--RPHRYRSF------MIEEILTEPPGP---------------------KGAAPAAAAAA 52

  Fly   114 AG---------LLAA----------------------AASGANGDRDANGGSGPGSGG--GTSGG 145
            ||         ||||                      |..|.:|...|...:|||..|  |||  
  Rat    53 AGELLKFGVQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLGSALLAAGPGMPGTAGTS-- 115

  Fly   146 YAEH---------KLQLSKSG------RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAE 195
               |         ||:.:.||      :|.||.||.||..||..||::|..|||||..||.|:||
  Rat   116 ---HLPLELQLRGKLEAAGSGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAE 177

  Fly   196 TLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGG 243
            :|.||:.||||||||||.|||:                   :|..|||
  Rat   178 SLGLSQLQVKTWYQNRRMKWKK-------------------IVLQGGG 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 34/53 (64%)
Barx1NP_001102350.1 Homeobox 145..198 CDD:278475 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.