DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and B-H1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster


Alignment Length:362 Identity:109/362 - (30%)
Similarity:150/362 - (41%) Gaps:93/362 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLIRDLLGD-----LINRRQTDSELELSNDDSDIDIEDRSTP---------------DSTAAGCQ 51
            |:|.|:|..     ...::|...:|...|::::......|:|               .|..||..
  Fly    77 FMINDILAGSAAAAFYKQQQHHQQLHHHNNNNNSGSSGGSSPAHSNNNNNINGDNCEASNVAGVG 141

  Fly    52 QELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVAS---------GLSAAA 107
            ......||.:   .|..:...:...|...|....|......||.|..||.         ..:|||
  Fly   142 VLPSALHHPQ---PHPPTHPHTHPHALMHPHGKLGHFPPTAGGNGLNVAQYAAAMQQHYAAAAAA 203

  Fly   108 AAA--GVAAGLLAAAASGANG------DRDANGGSG--PGSGGG--------------TSGGYAE 148
            |||  ..||...||||:.|.|      |...:||.|  |.:||.              .||...:
  Fly   204 AAARNNAAAAAAAAAAAAAAGVAAPPVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMDD 268

  Fly   149 HKL-------------------QLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVA 194
            |.:                   .:|...:|.|:.|||||..||..||:.|..||||||.:|.::|
  Fly   269 HSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELA 333

  Fly   195 ETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQ---ATMEKDFVVQDGGGAGGLGCCPSGLSS 256
            ..|:||:.||||||||||||||||..:.||.|...   |..::.:     ||:..||..|     
  Fly   334 HKLDLSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGNFAAFQRLY-----GGSPYLGAWP----- 388

  Fly   257 SFSAAAAAAAAASNPCN----FLTSAAAAAIFRNVGY 289
             ::|||.||..|:...|    :..:|||||:.:.:.|
  Fly   389 -YAAAAGAAHGATPHTNIDIYYRQAAAAAAMQKPLPY 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 33/52 (63%)
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
43.810

Return to query results.
Submit another query.