DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and B-H2

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_523386.1 Gene:B-H2 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster

Alignment Length:282 Identity:93/283 (33%)
Similarity:119/283 (42%) Gaps:76/283 (27%)


  Fly    56 LSH--HHRRFTH--HDESSVESCLSATRG----------------------------------PG 82
            |||  ||....|  |||.|....:....|                                  .|
  Fly   242 LSHQQHHPHLHHPMHDERSRSPLMLQQLGGNGGNNNNNNNNSSSASNNNNNNNNSASANSNIISG 306

  Fly    83 SGTGSGGGGGGGGG----GGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTS 143
            :.:.|....|.|.|    ||..|.:|      |..|..:..:.|...|.:|.:|.....:|...:
  Fly   307 NSSSSNNNNGSGNGNMLLGGPGSSIS------GDQASTIDDSDSDDCGGKDDDGDDSMKNGSSAN 365

  Fly   144 GGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWY 208
            |..:.| |.||.| :|.|:.|||||..||..||:.|..||||||.||.::|..|.||:.||||||
  Fly   366 GDSSSH-LSLSLS-KKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWY 428

  Fly   209 QNRRTKWKRQNQLRLEQLR---HQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASN 270
            ||||||||||..:.||.|.   :.|..::.:    ||....|...|          .||||||.:
  Fly   429 QNRRTKWKRQTAVGLELLAEAGNYAAFQRLY----GGATPYLSAWP----------YAAAAAAQS 479

  Fly   271 P---------CNFLTSAAAAAI 283
            |         ..:..:|||||:
  Fly   480 PHGATPSAIDIYYRQAAAAAAM 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 35/53 (66%)
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.