DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HOXC5

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:143 Identity:41/143 - (28%)
Similarity:63/143 - (44%) Gaps:35/143 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 AAAASGANGDRDANGGSGPG------------SGGGTSGGYAEHKLQ------LSKSGRKP---- 160
            ||||.|....||......||            ....:||...|.:.|      ||:....|    
Human    78 AAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYP 142

  Fly   161 -------------RRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRR 212
                         :|.||::|..|...||::|...:||:...|.::|..|.|:|.|:|.|:||||
Human   143 WMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRR 207

  Fly   213 TKWKRQNQLRLEQ 225
            .|||:.::::.::
Human   208 MKWKKDSKMKSKE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 24/55 (44%)
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 16/62 (26%)
Antp-type hexapeptide 140..145 0/4 (0%)
Homeodomain 156..212 CDD:459649 24/55 (44%)

Return to query results.
Submit another query.