DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and Nkx1-2

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001163947.1 Gene:Nkx1-2 RGDID:1306744 Length:305 Species:Rattus norvegicus

Alignment Length:317 Identity:89/318 (28%)
Similarity:121/318 (38%) Gaps:85/318 (27%)


  Fly     6 SFLIRDLLGD--------------LINRRQTDSELELSNDD-SDIDIEDRSTPDSTAAGCQQELL 55
            ||.:.|:|..              .:..:::..|:|...|. |...|..:.|||:...|......
  Rat    19 SFSVLDILDPQKFTRAALPPVRLAALEAKKSLVEVEAGEDACSGNPIGSQETPDAVGGGTDPASP 83

  Fly    56 LSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAA 120
            :.....    .:|...|....|.| |....|:..|           .|.|.|.|.|.        
  Rat    84 VEGSEA----EEEEEAEDAGRAQR-PERWQGAHAG-----------SLEAGAVAVGT-------- 124

  Fly   121 ASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYL 185
                    :.:|..|..:..|:.|.....:.:...|..||||.|||||:.||..||.|||..:||
  Rat   125 --------EESGADGLPASPGSPGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYL 181

  Fly   186 SVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGG-------- 242
            ||.:|.::|.:|:|:|||||.|:||||||||:||.            ..|..||.||        
  Rat   182 SVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNP------------GADGAVQAGGSAPQPGTP 234

  Fly   243 ----GAGGL-----------GCCPSGLSSSFSAAAAAAAAASNPCNFLTSAAAAAIF 284
                |.||.           |..|.....::.|......|||.|   ||:.|..:.|
  Rat   235 NAVTGGGGSATGSSPGPPVPGALPFQTFPTYPATNVLFPAASFP---LTTTATGSPF 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 33/53 (62%)
Nkx1-2NP_001163947.1 Homeobox 160..212 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.