DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and Dbx1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001009644.1 Gene:Dbx1 RGDID:1308896 Length:335 Species:Rattus norvegicus

Alignment Length:269 Identity:67/270 (25%)
Similarity:94/270 (35%) Gaps:99/270 (37%)


  Fly     1 MQSS----KSFLIRDLLGDLINRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHR 61
            :||:    .|||:.||:  .|:|..|              ...||.|.::.:..:||        
  Rat    29 LQSAFSGHSSFLVEDLI--RISRPPT--------------YLPRSIPTASLSPPRQE-------- 69

  Fly    62 RFTHHDESSVESCLSATRGPGSGTGSGGGGGGGG--GGGVASGLSAAAAAAGVAAGLLAAAASGA 124
                          :.|....|||...|..|.|.  |....:.||.|:....:..|:.|..:|..
  Rat    70 --------------APTALADSGTSDLGSPGSGSRRGSSPQTALSPASEPTFLKFGVNAILSSAP 120

  Fly   125 NGDRDANGGSGPGSGGGTSGG-------------YAEHKLQ------------------------ 152
            ..:              ||..             |.|...|                        
  Rat   121 RRE--------------TSPALLQSPPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWP 171

  Fly   153 LSKSGRKPRR---RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTK 214
            |:..| ||||   ||..|:..|...||:.|:.|||:|..||..:|..|.|.::|||.|:||||.|
  Rat   172 LAARG-KPRRGMLRRAVFSDVQRKALEKTFQKQKYISKPDRKKLASKLGLKDSQVKIWFQNRRMK 235

  Fly   215 WKRQNQLRL 223
            |:...:..|
  Rat   236 WRNSKEREL 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/53 (49%)
Dbx1NP_001009644.1 Homeobox 184..237 CDD:278475 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.