DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and Npm1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_008765768.1 Gene:Npm1 RGDID:3192 Length:316 Species:Rattus norvegicus

Alignment Length:93 Identity:22/94 (23%)
Similarity:39/94 (41%) Gaps:15/94 (16%)


  Fly     3 SSKSFL--IRDLLGDLINRRQ---------TDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLL 56
            |.:.||  |...:..|.|.||         :.:.|.|..|..|:|:.. ..|.:...||:.:...
  Rat    23 SPRPFLGVIPSCVSVLRNSRQLFSVRLLSHSSARLHLMEDSMDMDMSP-LRPQNYLFGCELKADK 86

  Fly    57 SHHHRRFTHHDESSVE-SCLSATRGPGS 83
            .:|.:  ..:||:..: |..:.:.|.|:
  Rat    87 DYHFK--VDNDENEHQLSLRTVSLGAGA 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475
Npm1XP_008765768.1 Nucleoplasmin 74..>178 CDD:281111 8/42 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.