DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and Obox6

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_663756.2 Gene:Obox6 MGIID:2149036 Length:347 Species:Mus musculus

Alignment Length:77 Identity:22/78 (28%)
Similarity:41/78 (53%) Gaps:1/78 (1%)


  Fly   143 SGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
            |..|.:.::.| .:.||.|:.||.:|..|...|::.|....|.|...|..:|..:.::..:::.|
Mouse   129 SPSYGDRRVSL-VTPRKHRKIRTVYTEEQKCVLKKHFHKCTYPSREQRMALAVLVGVTANEIQIW 192

  Fly   208 YQNRRTKWKRQN 219
            ::|.|.|.||::
Mouse   193 FKNHRAKSKRES 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 14/53 (26%)
Obox6NP_663756.2 COG5576 86..>204 CDD:227863 22/76 (29%)
homeodomain 146..204 CDD:238039 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.