DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and ceh-5

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_492586.2 Gene:ceh-5 / 191616 WormBaseID:WBGene00000430 Length:134 Species:Caenorhabditis elegans


Alignment Length:81 Identity:36/81 - (44%)
Similarity:50/81 - (61%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTK 214
            ||.|    .:|:|.||.||..||..||..|....|||.:.|:.:||:|.||:.|||.|:||||||
 Worm    29 KLDL----ERPKRPRTVFTDEQLEKLEESFNTSGYLSGSTRAKLAESLGLSDNQVKVWFQNRRTK 89

  Fly   215 WKR---QNQLRLEQLR 227
            .|:   ::.::.|.|:
 Worm    90 QKKIDSRDPIKPETLK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 29/55 (53%)
ceh-5NP_492586.2 Homeodomain 36..92 CDD:459649 29/55 (53%)

Return to query results.
Submit another query.