DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and DBX1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001025036.2 Gene:DBX1 HGNCID:33185 Length:343 Species:Homo sapiens

Alignment Length:250 Identity:61/250 (24%)
Similarity:83/250 (33%) Gaps:89/250 (36%)


  Fly    40 RSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGPG---------------------- 82
            |.||..|.....|.        .|:.|....||..:..:|.|.                      
Human    18 RPTPTLTLPQSLQS--------AFSGHSSFLVEDLIRISRPPAYLPRSVPTASMSPPRQGAPTAL 74

  Fly    83 SGTGSGG----GGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTS 143
            :.||:..    |.|...||...:..|.|:....:..|:.|..:||...:              ||
Human    75 TDTGASDLGSPGPGSRRGGSPPTAFSPASETTFLKFGVNAILSSGPRTE--------------TS 125

  Fly   144 GG-------------YAEHKLQ------------------------LSKSGRKPRR---RRTAFT 168
            ..             |.|...|                        |:..| ||||   ||..|:
Human   126 PALLQSVPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARG-KPRRGMLRRAVFS 189

  Fly   169 HAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRL 223
            ..|...||:.|:.|||:|..||..:|..|.|.::|||.|:||||.||:...:..|
Human   190 DVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQVKIWFQNRRMKWRNSKEREL 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/53 (49%)
DBX1NP_001025036.2 Homeobox 184..237 CDD:278475 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.