DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and LOC103692168

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_008761305.1 Gene:LOC103692168 RGDID:9451642 Length:240 Species:Rattus norvegicus

Alignment Length:126 Identity:46/127 (36%)
Similarity:61/127 (48%) Gaps:29/127 (23%)


  Fly   135 GPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNL 199
            |||:|                 .|:.|:.|||||..|:..|||:|..||||:.::|..:|..|.|
  Rat   119 GPGTG-----------------VRRRRKSRTAFTPQQVLELERRFVFQKYLAPSERDGLAARLGL 166

  Fly   200 SETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSA 260
            :..||.||:||||.|.||.    :|::|      .|.....|...|.|  ||..|..|.|:
  Rat   167 ANAQVVTWFQNRRAKLKRD----VEEMR------ADLASLCGLSPGVL--CPPALPDSASS 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 27/53 (51%)
LOC103692168XP_008761305.1 Homeobox 130..183 CDD:278475 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.