DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and evx2

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002935724.3 Gene:evx2 / 100498260 XenbaseID:XB-GENE-852923 Length:502 Species:Xenopus tropicalis


Alignment Length:105 Identity:24/105 - (22%)
Similarity:41/105 - (39%) Gaps:23/105 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DPLLSQHLLEGYSEEELQEYRQVFNMFDADRSGAI--AIDELEAAIKNLGLEQTR------DELD 95
            ||:| ..|.|||.:..    :.||.....::...:  .||.||........|..|      ||:.
 Frog   391 DPVL-MSLKEGYKKSS----KMVFKAPIKEKKSVVVNGIDLLENVPPRTENELLRMFFRQQDEIR 450

  Fly    96 KIIDEVDQRGNHQIDFDEFCVVMRRLTMKKSNWNEVVKEC 135
            ::.:|:.|:.          :.:|:|.::..|.....|.|
 Frog   451 RLKEELAQKD----------IRIRQLQLELKNLRNSPKNC 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649
evx2XP_002935724.3 Homeodomain 255..311 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.