DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and nkx1-1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002936812.1 Gene:nkx1-1 XenbaseID:XB-GENE-488879 Length:408 Species:Xenopus tropicalis

Alignment Length:302 Identity:89/303 (29%)
Similarity:112/303 (37%) Gaps:87/303 (29%)


  Fly     6 SFLIRDLL-------------------GDLINRRQTDS--------------ELELSNDDSDIDI 37
            ||.:.|:|                   ||.|.|.:..:              |.|.....:::..
 Frog    85 SFSVLDILDPNKFNSKQRHCSGAYKPPGDYILRGEEKAEGPDIATGQKAFLEEYESCKKSTEVIK 149

  Fly    38 EDRSTPDSTAAGCQ-QELLLSHHHRRFTHHDESSVESCLS-----------ATRGPGSGTGSGGG 90
            |:.....|....|| ||...|.........||...|...|           |.|.||:|.|.|  
 Frog   150 EEGLYQHSATEDCQTQEFSPSPGSDLEEEEDEEEDEEICSEESSNSTPSGLAERDPGAGNGQG-- 212

  Fly    91 GGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSK 155
                          ..|...|..||......:|.|..:....|.......|:.          ||
 Frog   213 --------------EDALNTGAPAGSNQQQPTGKNQQQQNQHGKPKRKRTGSD----------SK 253

  Fly   156 SGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
            || ||||.|||||:.||..||.||:..:||||.:|.::|.:|:|:|||||.|:||||||||:||.
 Frog   254 SG-KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNP 317

  Fly   221 LRLEQLRHQATMEKDFVVQDGG---GAGGLGCCPSGLSSSFS 259
                        ..|.....||   |.||.|....|..|..|
 Frog   318 ------------GADTSAPTGGSGHGGGGSGSVLGGGLSPLS 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/53 (60%)
nkx1-1XP_002936812.1 Homeobox 261..313 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.