DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and barx1

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_004914882.1 Gene:barx1 XenbaseID:XB-GENE-919916 Length:253 Species:Xenopus tropicalis

Alignment Length:133 Identity:57/134 (43%)
Similarity:69/134 (51%) Gaps:34/134 (25%)


  Fly   101 SGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQL------------ 153
            |.||..|..:.:::.||||             |||...|.||     .|.|.|            
 Frog    83 SPLSCPALGSPISSALLAA-------------GSGLQGGPGT-----PHHLPLELHLRGKLESSV 129

  Fly   154 SKSG----RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTK 214
            |:.|    :|.||.||.||..||..||::|..|||||..||.|:||:|.||:.||||||||||.|
 Frog   130 SEQGGSKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMK 194

  Fly   215 WKR 217
            ||:
 Frog   195 WKK 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 34/53 (64%)
barx1XP_004914882.1 Homeobox 143..196 CDD:278475 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.