DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and hlx

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_004914850.1 Gene:hlx XenbaseID:XB-GENE-483226 Length:397 Species:Xenopus tropicalis

Alignment Length:269 Identity:64/270 (24%)
Similarity:100/270 (37%) Gaps:52/270 (19%)


  Fly    29 SNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGPGSGTG------- 86
            :|:.|...:...:.|    |.|.::|             :..::..|||...|....|       
 Frog   115 TNNSSRARMHKSTQP----APCSKDL-------------KFGIDRILSAEFDPKVKEGNTLRDLT 162

  Fly    87 ---SGGGGGGGGG---GGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTS-- 143
               |.|...|..|   ...|....|.....|.|:.||................:.||.|....  
 Frog   163 SLISAGQQSGLPGQHMQSTAGHFFAPLEPLGEASSLLGQLNGSQRSSVQQFQDTFPGDGSRKLYM 227

  Fly   144 -GGYAEHKLQLSKS------GRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSE 201
             |.||    .|:|.      .||....|..|::.|...||::|..|||::..||..:|..|.|::
 Frog   228 WGPYA----VLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEVQKYVTKPDRKQLAAMLGLTD 288

  Fly   202 TQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAA 266
            .|||.|:||||.||:...:.:.::.:.:...||    .:..|:|.:     .:..|.|...:...
 Frog   289 AQVKVWFQNRRMKWRHSKEAQAQKDKEKEEAEK----PEAPGSGEV-----QMDRSSSPYRSEGE 344

  Fly   267 AASNPCNFL 275
            :.|:.|..|
 Frog   345 SESSDCESL 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/53 (45%)
hlxXP_004914850.1 Homeobox 250..303 CDD:278475 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.