DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and nkx1-2

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_002937845.1 Gene:nkx1-2 XenbaseID:XB-GENE-854960 Length:246 Species:Xenopus tropicalis

Alignment Length:133 Identity:53/134 (40%)
Similarity:66/134 (49%) Gaps:34/134 (25%)


  Fly   134 SGPGSGGGTSGGYAEHKLQL----------SKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVA 188
            |||.....||.|..|...:.          |.:..||||.|||||:.||..||.:||..:||||.
 Frog    64 SGPEIKAETSPGEPEELPEKEENQETQNVPSVTNCKPRRARTAFTYEQLVALESRFRSSRYLSVC 128

  Fly   189 DRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGC---- 249
            :|..:|.||:|:|||||.|:||||||||:|..:                    |...|.||    
 Frog   129 ERLSLALTLHLTETQVKIWFQNRRTKWKKQQPI--------------------GSLEGRGCSIQN 173

  Fly   250 CPS 252
            ||:
 Frog   174 CPT 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 33/53 (62%)
nkx1-2XP_002937845.1 Homeobox 104..156 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.