DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and zfhx3b

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001352117.1 Gene:zfhx3b / 100333211 ZFINID:ZDB-GENE-030131-7577 Length:3838 Species:Danio rerio


Alignment Length:355 Identity:73/355 - (20%)
Similarity:104/355 - (29%) Gaps:134/355 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESSVES------------- 73
            :|.|.||..::.|.::||    :.||..|...   |....||......|.:|             
Zfish   509 SDEEDELLLEEEDEEVED----EGTAVACSGS---SSSSGRFVGEPAVSNQSISKSPLLMPSSAL 566

  Fly    74 ----CLSAT----------------RGPGSGTGSGGGG---------------------GGGGGG 97
                ||||.                ||...|..:.|||                     ...|.|
Zfish   567 QPSACLSAASPALSSKFSASMSSSIRGAEDGMAADGGGRTSELPLSFNCQGSTVPMAMAAVAGRG 631

  Fly    98 GVASGLSAAAAAAGVAAGLLAAAASGANGDRDA----NGGSGPGSGGGTSGGYAEHKLQLSKSGR 158
            |...|  ||.:||..::.|.:.||:..:.:||:    .....|..|...:|....|.|.......
Zfish   632 GEEDG--AACSAASTSSPLASNAAAEESANRDSATAPEPNECPAEGDEDNGALLHHHLHHHHHHL 694

  Fly   159 KPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAE---------------------------- 195
            .|  ...|.||..            :.:..|.|.::|                            
Zfish   695 HP--SPNAHTHLH------------HTAACDLSGISECTQNHGAGGSGGSGVECPKCDTVLGSSR 745

  Fly   196 ------TLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGC--CPS 252
                  |:..|....|| .:..:..|..:.|..||     |.|::..  .|.||:    |  |.|
Zfish   746 SLGGHMTMMHSRNSCKT-LKCPKCNWHYKYQQTLE-----AHMKEKH--PDSGGS----CVYCSS 798

  Fly   253 GLSSSFSAAAAAAAAASNP-----CNFLTS 277
            |.|....|...:......|     ||:.|:
Zfish   799 GQSHPRLARGESYTCGYKPFRCEVCNYSTT 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 10/86 (12%)
zfhx3bNP_001352117.1 C2H2 Zn finger 734..755 CDD:275368 1/20 (5%)
C2H2 Zn finger 765..802 CDD:275368 13/47 (28%)
C2H2 Zn finger 820..837 CDD:275368 3/9 (33%)
PHA00732 1339..>1391 CDD:177300
C2H2 Zn finger 1489..1509 CDD:275368
C2H2 Zn finger 1527..1552 CDD:275368
C2H2 Zn finger 1555..1574 CDD:275368
SFP1 <1610..1739 CDD:227516
C2H2 Zn finger 1672..1696 CDD:275368
C2H2 Zn finger 1723..1741 CDD:275368
HOX 2283..2339 CDD:197696
Homeobox 2383..2436 CDD:306543
Abdominal-A 2723..2868 CDD:332641
Homeobox 2775..2827 CDD:306543
Abdominal-A 3031..>3137 CDD:332641
Homeobox 3073..3125 CDD:306543
Herpes_BLLF1 <3228..>3401 CDD:330317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.