DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11085 and chn1

DIOPT Version :9

Sequence 1:	NP_572815.3	Gene:	CG11085 / 32213	FlyBaseID:	FBgn0030408	Length:	295	Species:	Drosophila melanogaster
Sequence 2:	XP_012825384.1	Gene:	chn1 / 100038142	XenbaseID:	XB-GENE-852930	Length:	459	Species:	Xenopus tropicalis

Alignment Length:	61	Identity:	15/61 - (24%)
Similarity:	22/61 - (36%)	Gaps:	16/61 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly    37 IEDRSTPDSTA--------------AGCQQELLLSHHHRRFTHHDESSVESC--LSATRGP 81
            :|....||..|              |.|:....|..|.:|.|.|::.::.|.  |....||
Frog   364 LESAKAPDPDAQLETLHDALKLLPPAHCETLRYLMAHLKRVTLHEKDNLMSAENLGIVFGP 424

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11085	NP_572815.3	Homeobox	163..216	CDD:278475
chn1	XP_012825384.1	SH2_a2chimerin_b2chimerin	42..128	CDD:198215
		C1_1	206..255	CDD:365894
		RhoGAP_chimaerin	266..459	CDD:239837	15/61 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0488
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
	2	1.860