DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11085 and barhl2

Sequence 1:NP_572815.3 Gene:CG11085 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_991303.1 Gene:barhl2 ZFINID:ZDB-GENE-050913-153 Length:364 Species:Danio rerio

Alignment Length:291 Identity:84/292 (29%)
Similarity:113/292 (39%) Gaps:110/292 (38%)


  Fly     3 SSKSFLIRDLLGDLINRRQTDSE---------LELSNDDSDIDIEDRSTPDSTAAGCQQELLLSH 58
            ::.||||:|:||        ||:         ..:.:.......|..:.||......:|:...|.
Zfish   114 ATSSFLIKDILG--------DSKPLAACAPYSTSVPSPHHSPKTESGTAPDGIRPKLEQDENRSK 170

  Fly    59 HHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASG 123
            ..:|   .|..|...||:.|:                                            
Zfish   171 LDKR---DDIQSDLKCLNGTK-------------------------------------------- 188

  Fly   124 ANGDRDANGG--SGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLS 186
            ..|||:.:..  |.|                  ...:|||:.||||:..||..|||.|..|||||
Zfish   189 EEGDREISSSRDSPP------------------VRSKKPRKARTAFSDHQLNQLERSFERQKYLS 235

  Fly   187 VADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLR---HQATMEKDFVVQDGGGAGGLG 248
            |.||.|:|..|||::|||||||||||||||||..:.||.|.   :.:.:::.|            
Zfish   236 VQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMF------------ 288

  Fly   249 CCPS---------GLSSSFSAAAAAAAAASN 270
              ||         |...|.:|||||||..|:
Zfish   289 --PSPYFYHPSLLGTVDSTTAAAAAAAMYSS 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 37/53 (70%)
barhl2NP_991303.1 COG5576 <190..299 CDD:227863 54/141 (38%)
Homeobox 213..265 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.