DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and barhl2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_991303.1 Gene:barhl2 / 100001699 ZFINID:ZDB-GENE-050913-153 Length:364 Species:Danio rerio


Alignment Length:291 Identity:84/291 - (28%)
Similarity:113/291 - (38%) Gaps:110/291 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSKSFLIRDLLGDLINRRQTDSE---------LELSNDDSDIDIEDRSTPDSTAAGCQQELLLSH 58
            ::.||||:|:||        ||:         ..:.:.......|..:.||......:|:...|.
Zfish   114 ATSSFLIKDILG--------DSKPLAACAPYSTSVPSPHHSPKTESGTAPDGIRPKLEQDENRSK 170

  Fly    59 HHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASG 123
            ..:|   .|..|...||:.|:                                            
Zfish   171 LDKR---DDIQSDLKCLNGTK-------------------------------------------- 188

  Fly   124 ANGDRDANGG--SGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLS 186
            ..|||:.:..  |.|                  ...:|||:.||||:..||..|||.|..|||||
Zfish   189 EEGDREISSSRDSPP------------------VRSKKPRKARTAFSDHQLNQLERSFERQKYLS 235

  Fly   187 VADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLR---HQATMEKDFVVQDGGGAGGLG 248
            |.||.|:|..|||::|||||||||||||||||..:.||.|.   :.:.:::.|            
Zfish   236 VQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMF------------ 288

  Fly   249 CCPS---------GLSSSFSAAAAAAAAASN 270
              ||         |...|.:|||||||..|:
Zfish   289 --PSPYFYHPSLLGTVDSTTAAAAAAAMYSS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 36/52 (69%)
barhl2NP_991303.1 COG5576 <190..299 CDD:227863 54/140 (39%)
Homeobox 213..265 CDD:278475 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.